Recombinant Full Length Staphylococcus Aureus Heme Sensor Protein Hsss(Hsss) Protein, His-Tagged
Cat.No. : | RFL19851SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Heme sensor protein hssS(hssS) Protein (Q2FED4) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hssS |
Synonyms | hssS; SAUSA300_2309; Heme sensor protein HssS |
UniProt ID | Q2FED4 |
◆ Recombinant Proteins | ||
IGHMBP2-2667R | Recombinant Rat IGHMBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLL4-2687H | Recombinant Human DLL4 Protein, GST-tagged | +Inquiry |
IL11-503H | Recombinant Human IL11 protein, His-tagged | +Inquiry |
SIRPA-1372H | Recombinant Human SIRPA protein(Met1-Arg369), His-tagged, Biotinylated | +Inquiry |
RFL7538AF | Recombinant Full Length Acidianus Two-Tailed Virus Putative Transmembrane Protein Orf710 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC16-7670HCL | Recombinant Human CDC16 293 Cell Lysate | +Inquiry |
Small Intestine-453P | Porcine Small Intestine Lysate | +Inquiry |
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Umbilical Cord-11H | Human Fetal Umbilical Cord Membrane Lysate | +Inquiry |
UFSP2-09HL | Recombinant Human UFSP2 HEK293T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hssS Products
Required fields are marked with *
My Review for All hssS Products
Required fields are marked with *
0
Inquiry Basket