Recombinant Full Length Staphylococcus Aureus Cardiolipin Synthase 1(Cls1) Protein, His-Tagged
Cat.No. : | RFL3980SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Cardiolipin synthase 1(cls1) Protein (Q6GH88) (1-493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-493) |
Form : | Lyophilized powder |
AA Sequence : | MQFSFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVLPLIGFI LYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQVQKHHDLVRMLLM DQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKL KQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRMNNRNHRKIIIID GQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWNSQAHRPQFEYDV KYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQSPYFIPDNSYINA IKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENGFIHSKMCLIDDE IVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLTEESYANRPLSVK FKESLAKLVSPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls1 |
Synonyms | cls1; SAR1328; Cardiolipin synthase 1; CL synthase 1 |
UniProt ID | Q6GH88 |
◆ Recombinant Proteins | ||
DNAJB4-213C | Recombinant Cynomolgus Monkey DNAJB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RMI1-7625M | Recombinant Mouse RMI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BLCAP-542R | Recombinant Rhesus monkey BLCAP Protein, His-tagged | +Inquiry |
CNR1-1498R | Recombinant Rat Cnr1 Protein | +Inquiry |
RHO-355H | Recombinant Human RHO | +Inquiry |
◆ Native Proteins | ||
dsbA-8328E | Native E.coli dsbA | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC23IP-1992HCL | Recombinant Human SEC23IP 293 Cell Lysate | +Inquiry |
BCS1L-167HCL | Recombinant Human BCS1L cell lysate | +Inquiry |
SK-N-SH-01HL | Human SK-N-SH lysate | +Inquiry |
NSDHL-1223HCL | Recombinant Human NSDHL cell lysate | +Inquiry |
CHODL-1746MCL | Recombinant Mouse CHODL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls1 Products
Required fields are marked with *
My Review for All cls1 Products
Required fields are marked with *
0
Inquiry Basket