Recombinant Full Length Spodoptera Frugiperda Ascovirus 1A Putative Esterase(Orf13) Protein, His-Tagged
Cat.No. : | RFL17035SF |
Product Overview : | Recombinant Full Length Spodoptera frugiperda ascovirus 1a Putative esterase(ORF13) Protein (Q0E588) (1-592aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Spodoptera frugiperda ascovirus 1a (SfAV-1a) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-592) |
Form : | Lyophilized powder |
AA Sequence : | MCVNRVRSIVSLTLIAYLSVLMGVSVYFYVLIESVYQQFSDMSENYVQLVKDTSSTPIVV ATHGHSTNRSHQSVLFTARADVNISMETILHVEFNYTTALGTMDDTFNIINFYGLKYRHV DLIDPFGNSLPVVNSKSSFGFTDCSSDERVRCPSTRRPFTGTLDCLTLDMHMQSWNRDRS TDHFKRPIIIWLGEIMGSLWRLIGNGVIVIRVNYRRGVYGFVCHRDERLPYYNQGVNDVM HAIEWVTENAERFAGDTKRITLAGHGDDGKVVEYVRMYHSHHLPLDKYIVMSAAETGSRD LTCSSNSNILVTAARILGMPSVPVHDTTAGERGVYDAVRYLSFIEPKRLMERLYDLKEIF QPCPGEIRSTASDVNGLGKAFEGVDSDDCKFINTDTPVLYMNTLNEYANKVKLDDSFMHA RAHTLRRVIEHVLARRFKPHRVTRYCNVTISEPAEIGSERYEPCDGEVINVESLGRVLTD FEYIAPTSRICEAAVGCGASFYHYVYDFKNASHGDDLRLLMSEHDQRNLTKFERQLADGI GMMISRFVRRGYPVVKRDNWCSSTSLVAQIMEINTTPNVITTQTQVRGTVER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF13 |
Synonyms | ORF13; Putative esterase |
UniProt ID | Q0E588 |
◆ Recombinant Proteins | ||
KRTCAP2-4339Z | Recombinant Zebrafish KRTCAP2 | +Inquiry |
SSNA1-4303R | Recombinant Rhesus Macaque SSNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
F317L-1124A | Recombinant ASFV F317L Protein (Met1-Thr317), N-His tagged | +Inquiry |
CYP4V3-1413R | Recombinant Rat CYP4V3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LECT1-6748Z | Recombinant Zebrafish LECT1 | +Inquiry |
◆ Native Proteins | ||
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
YES1-620HCL | Recombinant Human YES1 cell lysate | +Inquiry |
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
FKRP-6199HCL | Recombinant Human FKRP 293 Cell Lysate | +Inquiry |
PPP1R2P3-1401HCL | Recombinant Human PPP1R2P3 cell lysate | +Inquiry |
TMEM47-948HCL | Recombinant Human TMEM47 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF13 Products
Required fields are marked with *
My Review for All ORF13 Products
Required fields are marked with *
0
Inquiry Basket