Recombinant Full Length Southern Cowpea Mosaic Virus Replicase Polyprotein P2Ab (Orf2A-2B) Protein, His-Tagged
Cat.No. : | RFL16225SF |
Product Overview : | Recombinant Full Length Southern cowpea mosaic virus Replicase polyprotein P2AB (ORF2A-2B) Protein (P21405) (403-956aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | SCPMV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (403-956) |
Form : | Lyophilized powder |
AA Sequence : | SFDGALPLNLLAGGRTQCLAAQIELGDYKFSCGPTHETGGMPFRNCGSSTCKFREVSRKP VADAVTAATKVFPELSELGWPERGSGAEIGSLLLQAGKFVPTKAPSNLEQAYNNLLSRYP RSKPLACFRQGTWSFDAIFEQVVSKATSAEINQKASPGVPLSRLATTNKDLMAQHMQFVA ACVTGRVPLLASFEDIHALSPTEMVEMGLCDPVRLFVKQEPHPSRKLKEGRYRLISSVSI VDQLVERMLFGAQNELEIAEWQSIPSKPGMGLSVIHQADAIFRDLRVKHTVCPAAEADIS GFDWSVQDWELWADVEMRIVLGSFPPMMARAARNRFSCFMNSVLQLSNGQLLQQELPGIM KSGSYCTSSTNSRIRCLMAELIGSPWCIAMGDDSVEGFVEGAREKYAGLGHLCKDYKPCA TTPTGQLYAVEFCSHVIKRNKAFLTSWPKTLYRFLSTPRETLEDLERELASSPMWHKIQS YVRSIPSPDKTARDKSICNGYPLDQEAISTSYSEYSSKSASAEATREAACCAGAQAYPSW GIHGPYCSGDHGEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF2A-2B |
Synonyms | ORF2A-2B; Replicase polyprotein P2AB |
UniProt ID | P21405 |
◆ Recombinant Proteins | ||
USP29-0348H | Recombinant Human USP29 Protein (I2-A922), Flag tagged | +Inquiry |
TAAR9-8950M | Recombinant Mouse TAAR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Retn-1209R | Recombinant Rat Retn Protein, His-tagged | +Inquiry |
Crlf1-1429M | Recombinant Mouse Crlf1 protein, His & T7-tagged | +Inquiry |
FAM101B-5445M | Recombinant Mouse FAM101B Protein | +Inquiry |
◆ Native Proteins | ||
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
COX1-31S | Active Native Sheep COX1 protein | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB1A1-1794MCL | Recombinant Mouse SCGB1A1 cell lysate | +Inquiry |
Parietal Lobe-375R | Rhesus monkey Parietal Lobe Lysate | +Inquiry |
MRI1-4203HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
RASGRP4-1477HCL | Recombinant Human RASGRP4 cell lysate | +Inquiry |
CORT-7339HCL | Recombinant Human CORT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF2A-2B Products
Required fields are marked with *
My Review for All ORF2A-2B Products
Required fields are marked with *
0
Inquiry Basket