Recombinant Full Length Sorghum Bicolor Casp-Like Protein Sb04G002820 (Sb04G002820) Protein, His-Tagged
Cat.No. : | RFL23918SF |
Product Overview : | Recombinant Full Length Sorghum bicolor CASP-like protein Sb04g002820 (Sb04g002820) Protein (C5XTX2) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MGLRDSLKEREDRRSSEEEGDARQSWMTRESTTGWRKESTAALGTPVADWQCVLLLQFGA LQQKLLKAFPRAGPRPTTTLVPARPERARKKPHSQPPPSTHMALQAQATASPSPSPSPTR GRTGSGEWPDDAEKLPIAATASPARSSDAVELVVVASTRHAAAAKYVPRRSTSHTADPNP GRGGGGGSAGWYSWNGGRTRTAAPPRHARADPPPAPPRRQQPVEAPPPPPPPPPPPAPAP ALPPPVPPSPPAPAQAPVPPSATAPAPAPVPAPRASSPHVQFRSADQVVPNILSRKRRAA AMQRTALLARGAAAGLCLAALAVLAADTRKGWARDSYSNYTQFRYSEAVNVIGFIYSVFQ FVALVELMRRNKHLIPHPKRDLFDFTMDQVLTYLLISSSSSATARVSDLIDNWGSDPFPS MANGSIAISFLAFAVFAICSLISAYNLFRRDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sb04g002820 |
Synonyms | Sb04g002820; CASP-like protein 4A1; SbCASPL4A1 |
UniProt ID | C5XTX2 |
◆ Recombinant Proteins | ||
RFL5645AF | Recombinant Full Length Arabidopsis Thaliana Secretory Carrier-Associated Membrane Protein 3(Scamp3) Protein, His-Tagged | +Inquiry |
SMYD1-15655M | Recombinant Mouse SMYD1 Protein | +Inquiry |
ATP1A1A.1-9213Z | Recombinant Zebrafish ATP1A1A.1 | +Inquiry |
RFL3447HF | Recombinant Full Length Human Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 3(Ndufa3) Protein, His-Tagged | +Inquiry |
Luciferase-08F | Recombinant Fire fly Luciferase | +Inquiry |
◆ Native Proteins | ||
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM98-922HCL | Recombinant Human TMEM98 293 Cell Lysate | +Inquiry |
LBR-4811HCL | Recombinant Human LBR 293 Cell Lysate | +Inquiry |
MEF2D-4374HCL | Recombinant Human MEF2D 293 Cell Lysate | +Inquiry |
WDR16-1924HCL | Recombinant Human WDR16 cell lysate | +Inquiry |
MRPL39-4173HCL | Recombinant Human MRPL39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sb04g002820 Products
Required fields are marked with *
My Review for All Sb04g002820 Products
Required fields are marked with *
0
Inquiry Basket