Recombinant Full Length Sordaria Macrospora Bifunctional Lycopene Cyclase/Phytoene Synthase(Putative Al2) Protein, His-Tagged
Cat.No. : | RFL36334SF |
Product Overview : | Recombinant Full Length Sordaria macrospora Bifunctional lycopene cyclase/phytoene synthase(putative al2) Protein (D1Z4K7) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sordaria macrospora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MYDYAFVHLKFTIPLAVLLTAIAYPVLNRIHVIQTGCLIFIAFTAALPWDAYLIEQKVWS YPPEAIVGPRLLGIPFEELFFFVIQTYITALVYILFNKPVLHALHLNNQRNPPAWMRIAK VTGQLILVALSVWGWKAAQVNQKTTYLGLILVWACPFLLAIWTLAGRFILSLPWFVTVLP VVLPTFYLWAVDELALHRGTWSIGSGTKLEYCLFGKLDIEEATFFLVTNMLIVSGMAVFD QYLAVIYAFPTLFPKVNRYPTPLMLVQSRLVNTTKYDLERIEGLREAVERLRLKSRSFYL ANSLFSGRLRIDLILLYSFCRLADDLVDDAKSRLEVLSWTAKLNHFLDQHYGDSDATEDP KQKAERIDAYIKEAFPPFAYQALHLLPTHILPPKPLYELIKGFEMDSQFTFHGSSDSTNL KFPIAHDKDLKTYAIRVAGTVGELCIALIIHHCLPDMSDSQKRRLESAACRMGIALQYVN IARDILVDAQIGRVYLPTSWLKEEGLTHKAVLDNPEGPEVIEKMRRRLLDNAFELYREAR PEMQQIPSEARGPMIGAVENYMEIGRVLREKKVGQVFVRKEGRATVPKQRRLRTLLRALY EQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | putative |
Synonyms | SMAC_01277; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | D1Z4K7 |
◆ Recombinant Proteins | ||
CD8B1-3115M | Recombinant Mouse CD8B1 Protein | +Inquiry |
PF4V1-212H | Recombinant Human PF4V1 Protein, His-tagged | +Inquiry |
GBP2-3243H | Recombinant Human GBP2 Protein (Thr35-Asn276), N-His tagged | +Inquiry |
Kcnip3-3659M | Recombinant Mouse Kcnip3 Protein, Myc/DDK-tagged | +Inquiry |
TNFSF13B-136C | Recombinant Cynomolgus TNFSF13B, Fc tagged | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP3-2047HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
Vagina Lupus-560H | Human Vagina Lupus Lysate | +Inquiry |
SLC19A3-599HCL | Recombinant Human SLC19A3 lysate | +Inquiry |
CCDC68-7754HCL | Recombinant Human CCDC68 293 Cell Lysate | +Inquiry |
BPGM-8417HCL | Recombinant Human BPGM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All putative Products
Required fields are marked with *
My Review for All putative Products
Required fields are marked with *
0
Inquiry Basket