Recombinant Full Length Sinorhizobium Medicae Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL23553SF |
Product Overview : | Recombinant Full Length Sinorhizobium medicae Undecaprenyl-diphosphatase(uppP) Protein (A6UFC2) (1-268aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium medicae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-268) |
Form : | Lyophilized powder |
AA Sequence : | MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFRSPGNTFAVLIQLGAILAILL VYFQKLLSIALALPTSVRARRFVLSVLLAFLPAALIGAAAHGFIKSVLFETPMLICVVLI VGGIILYVIDRLPLTPRYTDVFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTD KRSAAEFSFFLAMPTMVGAFALDLYKNREALSIDDIGLIAAGFIAAFIAGIFVVRSLLDF VSHRGFTPFAIWRILVGTAGLVGLWLLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Smed_3536; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A6UFC2 |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2326HCL | Recombinant H16N3 HA cell lysate | +Inquiry |
CSF2RB-2235HCL | Recombinant Human CSF2RB cell lysate | +Inquiry |
Fetal Bladder-128H | Human Fetal Bladder Lysate | +Inquiry |
CNTN3-3033HCL | Recombinant Human CNTN3 cell lysate | +Inquiry |
Vagina-562R | Rhesus monkey Vagina Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket