Recombinant Full Length Sorangium Cellulosum Cobalt Transport Protein Cbim(Cbim) Protein, His-Tagged
Cat.No. : | RFL16189SF |
Product Overview : | Recombinant Full Length Sorangium cellulosum Cobalt transport protein CbiM(cbiM) Protein (A9GQ89) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sorangium Cellulosum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-225) |
Form : | Lyophilized powder |
AA Sequence : | MHLAEGVLPLGWCAFWNALALPFVAIALHLLRRRTEQDAFYKPFVGLIAAAVFAISCMPV PVPTAGTCSHPCGTGLAAVLIGPWMTVLVTVVALLIQALFLAHGGLTTLGADVASMGIAG AFTGYFAFHLARRSGANLWVAGFLAGVTSDWATYATTALALALGLSGEGSVTSMFTGVAL AFVPTQLPLGLLEGVMTAGALAFLRARRPDILDRLQVVRLAPGAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiM |
Synonyms | cbiM; sce0249; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM |
UniProt ID | A9GQ89 |
◆ Recombinant Proteins | ||
BBS9-977M | Recombinant Mouse BBS9 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADH4-343M | Recombinant Mouse ADH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ART4-140C | Recombinant Cynomolgus ART4, Fc tagged | +Inquiry |
Dpo4-1036s | Recombinant synthetic construct Dpo4 protein, His-tagged | +Inquiry |
LECT2-2286H | Recombinant Human LECT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
DOC2B-502HCL | Recombinant Human DOC2B cell lysate | +Inquiry |
HIST1H1D-5552HCL | Recombinant Human HIST1H1D 293 Cell Lysate | +Inquiry |
ALOX5AP-667HCL | Recombinant Human ALOX5AP cell lysate | +Inquiry |
JAM2-2123MCL | Recombinant Mouse JAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cbiM Products
Required fields are marked with *
My Review for All cbiM Products
Required fields are marked with *
0
Inquiry Basket