Recombinant Full Length Solanum Tuberosum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 1(Hmg1) Protein, His-Tagged
Cat.No. : | RFL28118SF |
Product Overview : | Recombinant Full Length Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1(HMG1) Protein (P48020) (1-596aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum tuberosum (Potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-596) |
Form : | Lyophilized powder |
AA Sequence : | MDVRRRPVKPLYTSKDASAGEPLKQQEVSSPKASDALPLPLYLTNGLFFTMFFSVMYFLL VRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSDSWDIEDE NAEQLIIEEDSRRGPCAAATTLGCVVPPPPVRKIAPMVPQQPAKVALSQTEKPSPIIMPA LSEDDEEIIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLEGFDYSS ILGQCCEMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFVSGGADS VLLRDGMTRAPVVRFTTAKRAAELKFFVEDPLNFETLSLMFNKSSRFARLQGIQCAIAGK NLYITFSCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGISGNFCSDKKPAAVNWIEG RGKSVVCEAIIKEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVY LATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLG VKGANRDAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVKSHMKYNRSIKDISK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG1 |
Synonyms | HMG1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1; HMGR; HMGR1 |
UniProt ID | P48020 |
◆ Native Proteins | ||
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPS-7855HCL | Recombinant Human CAPS 293 Cell Lysate | +Inquiry |
STK38-1400HCL | Recombinant Human STK38 293 Cell Lysate | +Inquiry |
BUD13-69HCL | Recombinant Human BUD13 lysate | +Inquiry |
VWA5A-372HCL | Recombinant Human VWA5A 293 Cell Lysate | +Inquiry |
FERD3L-6263HCL | Recombinant Human FERD3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG1 Products
Required fields are marked with *
My Review for All HMG1 Products
Required fields are marked with *
0
Inquiry Basket