Recombinant Full Length Solanum Demissum Casp-Like Protein Sdm1_58T00016(Sdm1_58T00016) Protein, His-Tagged
Cat.No. : | RFL11968SF |
Product Overview : | Recombinant Full Length Solanum demissum CASP-like protein SDM1_58t00016(SDM1_58t00016) Protein (Q5NRN4) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum demissum (Wild potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MKAVSIEAGEGSKAKRVHGVNRGISVFDLVLRIVALVGTLASAVAMGTADQALSFSTQIV NFEAQYDDIDAFKFFVVSNSITCVYLALSIPISIFHIIRSRAGKSRVLLIVLDAIMLVFL TSGASAAAAIVYLAHNGNTSTNWFSICQQYTDFCQRSAGSLIGSFGAMALMVLLIILSSI ALSRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SDM1_58t00016 |
Synonyms | SDM1_58t00016; Casparian strip membrane protein 2; SdCASP2 |
UniProt ID | Q5NRN4 |
◆ Native Proteins | ||
HBsAg-321H | Active Native Hepatitis B Surface Ag Subtype Ad Protein | +Inquiry |
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMF1-2738HCL | Recombinant Human PSMF1 293 Cell Lysate | +Inquiry |
NEK2-1183HCL | Recombinant Human NEK2 cell lysate | +Inquiry |
JMJD7-350HCL | Recombinant Human JMJD7 lysate | +Inquiry |
NECAP2-1181HCL | Recombinant Human NECAP2 cell lysate | +Inquiry |
METTL25-8326HCL | Recombinant Human C12orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDM1_58t00016 Products
Required fields are marked with *
My Review for All SDM1_58t00016 Products
Required fields are marked with *
0
Inquiry Basket