Recombinant Full Length Silicibacter Sp. Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL1035RF |
Product Overview : | Recombinant Full Length Silicibacter sp. Membrane protein insertase YidC(yidC) Protein (Q1GJX6) (1-608aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ruegeria sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-608) |
Form : | Lyophilized powder |
AA Sequence : | MDDQNKNLLLATALSFLVILGWYFFFPPPEEAPQPATEVTETAPQGDTTAPAAAPSAGAA TAEVDAAAAETEITEDVPRLTIDTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLL SPAGQPHAYYALYGWAPGAGLGIEDVPTANTLWQAEAGATLTPDTPVTLTWDNGKGLTFS REVSIDEDYMFSITQSVTNSSGASVALAPYGTLARHGEPANLENFFVLHEGVVGMADGEL SEIDYDDMTDFDPDPRDGSRAQVNTVTENGWIGFTGHYWMSTLIPAPGEAFRAIAKYDER RDIYQTDVVLPTVTLAAGESTSANTQLFAGAKEWATIREYERAGIEGFLDSIDWGWFFFF TKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLRER AGDDRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAAFFGPFQ DLSVPDPTSLFNLFGLLPWAAPAPDSLLSLVFIGILPILLGVSMWVQQKLNPAPTDETQR MIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSGFKKD KAEKAEKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; TM1040_0307; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q1GJX6 |
◆ Recombinant Proteins | ||
KCNK4-8533M | Recombinant Mouse KCNK4 Protein | +Inquiry |
SRP68-1414Z | Recombinant Zebrafish SRP68 | +Inquiry |
Il13ra1-1737M | Recombinant Mouse Il13ra1 protein, His-tagged | +Inquiry |
LUC7L-6216HF | Recombinant Full Length Human LUC7L Protein, GST-tagged | +Inquiry |
VP2-1798A | Recombinant AAV-1 VP2 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP27A1-7119HCL | Recombinant Human CYP27A1 293 Cell Lysate | +Inquiry |
ARID3B-120HCL | Recombinant Human ARID3B cell lysate | +Inquiry |
CDK4-664HCL | Recombinant Human CDK4 cell lysate | +Inquiry |
DNAJB9-6881HCL | Recombinant Human DNAJB9 293 Cell Lysate | +Inquiry |
CHMP6-7529HCL | Recombinant Human CHMP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket