Recombinant Full Length Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL14725XF |
Product Overview : | Recombinant Full Length Membrane protein insertase YidC(yidC) Protein (Q5GTT3) (1-574aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-574) |
Form : | Lyophilized powder |
AA Sequence : | MNQTRVFLIFAWLMVAALLWMEWGKEKAAANAPVAAATQSVPAARDLDAATPSAANVPAA QAIPQAGAPGKVPATSTTTATPAAAGTAPVVTLTSDVLRLKLDGRSVLDAELLQFPQTKD GTAPVSLLTEDAAHPYNATSGWASEHSPVPGVGGFRAEQPGTTFELAKGQNTLVVPFVWN GPNGVSIRRTFTLERGRYAISIKDEVINKSAAPWNGYVFRKLSRVPTILSRGMTNPDSFS FNGATWYSPQAGYERRAFKDYMDDGGLNRQITGGWIALLQHHFFTAWIPQNDQASLYVLN KDGPRDVAELRGPAFTVAPGQTATTEARLWVGPKLVSLIAKEDVKGLDRVIDYSRFSIMA IIGQGLFWVLSHLHSFLHNWGWAIVGLVVLLRLVLYPLSSAQYKSSAKMRKFQPRLAQLK ERYGDDRVKYQQATMELFKKEKINPMGGCLPLLIQMPIFFALYWVLVESVELRQAPWLGW IQDLTARDPHFILPALNIAIMWATQKLTPTPGIDPMQAKMMQFMPLVFGAMMAFVPSGLV LYWVVNGGLNLLIQWWMIRQHGEKPSKIIRANAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; XOO4636; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q5GTT3 |
◆ Recombinant Proteins | ||
CSF3R-3120H | Recombinant Human Colony TtimulatingFactor 3 Receptor (Granulocyte) | +Inquiry |
PPM1A-4606R | Recombinant Rat PPM1A Protein | +Inquiry |
GRIN2C-2356R | Recombinant Rat GRIN2C Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP099B-004-2009S | Recombinant Staphylococcus aureus (strain: SK1271, other: AsaPcQacB) SAP099B_004 protein, His-tagged | +Inquiry |
ROR1-198H | Active Recombinant Human ROR1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FFAR2-6256HCL | Recombinant Human FFAR2 293 Cell Lysate | +Inquiry |
RPS21-1542HCL | Recombinant Human RPS21 cell lysate | +Inquiry |
EPM2AIP1-6582HCL | Recombinant Human EPM2AIP1 293 Cell Lysate | +Inquiry |
ADPRHL2-9001HCL | Recombinant Human ADPRHL2 293 Cell Lysate | +Inquiry |
CABYR-7906HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket