Recombinant Full Length Silicibacter Pomeroyi Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL20509RF |
Product Overview : | Recombinant Full Length Silicibacter pomeroyi Undecaprenyl-diphosphatase(uppP) Protein (Q5LLZ3) (1-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ruegeria pomeroyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-267) |
Form : | Lyophilized powder |
AA Sequence : | MSLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQGQVIDVAVHVGTLGAVVLYFW RDVRDGLAGLPRALTGRLDTPGARLAMGLIVATIPTVLAGAALHFTGLSDALRSITVIGW TMLLFGLLLWWADRTGAQVKEATDWSLRDALILGLWQAVALIPGTSRSGITITGARAMGY TRSDGARISMLMSIPTIIASGVLLGADVAVTSDAQAARDGAIAAAFAFVSALLALSLMMR LLRSVSFTPYVIYRLALGLVLLGIAYS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; SPO3771; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q5LLZ3 |
◆ Recombinant Proteins | ||
SLC34A2-5511R | Recombinant Rat SLC34A2 Protein | +Inquiry |
S-201C | Recombinant 2019-nCoV Spike RBD (E484K) mutation Protein, His-tagged | +Inquiry |
DCD-2799H | Recombinant Human DCD Protein, His-tagged, OVA Conjugated | +Inquiry |
Dmpk-1353M | Recombinant Mouse Dmpk Protein, His-tagged | +Inquiry |
LEUS-0823B | Recombinant Bacillus subtilis LEUS protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
F10-26946TH | Native Human F10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
FAHD2A-6468HCL | Recombinant Human FAHD2A 293 Cell Lysate | +Inquiry |
DNALI1-499HCL | Recombinant Human DNALI1 cell lysate | +Inquiry |
CASC4-7843HCL | Recombinant Human CASC4 293 Cell Lysate | +Inquiry |
NDRG2-3929HCL | Recombinant Human NDRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket