Recombinant Full Length Micrococcus Luteus Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL6358MF |
Product Overview : | Recombinant Full Length Micrococcus luteus Undecaprenyl-diphosphatase(uppP) Protein (C5CBT8) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Micrococcus luteus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | MTWIEAIILGLVQGLTEFLPISSSAHIRIVGEFLPSATDPGAAFTAITQLGTELAVLIYF WRDITRIIGRWSAAVTGRIPHSDPDARMGWLIIVGSIPIAVLGLLLEDWIDTEFRSLWIT ATMLIVFGVLLALADRLGRQTKPLEKLTVRDGVLYGLAQALALIPGVSRSGGTIAAGLAM GYTRPAATRYAFLLAVPAVFASGLYKLYTSLTDPGTQGPYGMGETLVATAVAFVVAYAVI AWLMRFISTNSYLPFVWYRILLGGVLFALLGAGVISA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Mlut_11800; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | C5CBT8 |
◆ Recombinant Proteins | ||
ZKSCAN6-10386M | Recombinant Mouse ZKSCAN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
EI-1164 | PF4618433 | +Inquiry |
BSG-1412M | Recombinant Mouse BSG protein, His-Avi-tagged, Biotinylated | +Inquiry |
CAPN5-1123R | Recombinant Rat CAPN5 Protein | +Inquiry |
Ins2-4180M | Recombinant Mouse Ins2 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
ICDH-209S | Active Native Swine Isocitrate Dehydrogenase | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL16-8717HCL | Recombinant Human ARL16 293 Cell Lysate | +Inquiry |
MRPS18C-4147HCL | Recombinant Human MRPS18C 293 Cell Lysate | +Inquiry |
HES4-781HCL | Recombinant Human HES4 cell lysate | +Inquiry |
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
KIAA1143-4968HCL | Recombinant Human KIAA1143 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket