Recombinant Full Length Shigella Sonnei Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged
Cat.No. : | RFL30725SF |
Product Overview : | Recombinant Full Length Shigella sonnei Fumarate reductase subunit C(frdC) Protein (Q3YUI6) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella sonnei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | frdC |
Synonyms | frdC; SSON_4338; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C |
UniProt ID | Q3YUI6 |
◆ Recombinant Proteins | ||
Tagln2-6285M | Recombinant Mouse Tagln2 Protein, Myc/DDK-tagged | +Inquiry |
DEFB7-4498M | Recombinant Mouse DEFB7 Protein | +Inquiry |
MEGF6-686H | Recombinant Human MEGF6 | +Inquiry |
FAXDC2-0090H | Recombinant Human FAXDC2 Protein, GST-Tagged | +Inquiry |
Agr2-1560M | Recombinant Mouse Agr2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM19-682HCL | Recombinant Human TMEM19 lysate | +Inquiry |
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
NDC80-952HCL | Recombinant Human NDC80 cell lysate | +Inquiry |
RNASEH2A-1515HCL | Recombinant Human RNASEH2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All frdC Products
Required fields are marked with *
My Review for All frdC Products
Required fields are marked with *
0
Inquiry Basket