Recombinant Full Length Salmonella Typhimurium Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged
Cat.No. : | RFL5979SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Fumarate reductase subunit C(frdC) Protein (P67638) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | frdC |
Synonyms | frdC; STM4341; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C |
UniProt ID | P67638 |
◆ Recombinant Proteins | ||
RFL13672NF | Recombinant Full Length New York Virus Envelope Glycoprotein(Gp) Protein, His-Tagged | +Inquiry |
OMPB-9552Z | Recombinant Zebrafish OMPB | +Inquiry |
COX6B1-11496H | Recombinant Human COX6B1, GST-tagged | +Inquiry |
HMGCR-6055C | Recombinant Chicken HMGCR | +Inquiry |
IFNG-61B | Active Recombinant Bovine Interferon, Gamma | +Inquiry |
◆ Native Proteins | ||
Trypsin-265H | Native Human Trypsin | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRB3-394HCL | Recombinant Human CRB3 cell lysate | +Inquiry |
RBM10-2482HCL | Recombinant Human RBM10 293 Cell Lysate | +Inquiry |
TBCEL-1215HCL | Recombinant Human TBCEL 293 Cell Lysate | +Inquiry |
BAG3-56HCL | Recombinant Human BAG3 lysate | +Inquiry |
IL1R2-1302RCL | Recombinant Rat IL1R2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All frdC Products
Required fields are marked with *
My Review for All frdC Products
Required fields are marked with *
0
Inquiry Basket