Recombinant Full Length Shewanella Sp. Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL7331SF |
Product Overview : | Recombinant Full Length Shewanella sp. Membrane protein insertase YidC(yidC) Protein (A0KR32) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MESQRNILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTSVPAA LTATQNLITVKTDQLDVQINPVGGDIVFAALVSHKLEQGKDQPFVLLEQTKDFTYIAQSG LIGRDGIDSSAKGRAAFAANKTEFTLADGQDTLEVPLTYVADNGVTYTKVFVFHRGKFNV DIDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGAAFSTQDVRYEKYKFEDMSK SNLNQPTLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLANIGFRGAVYDIAPGATQ EISSQFYVGPKDQKALSALSDTLNLVVDYGFLWWLAVPIHWLLMFYQSFVGNWGVAIILI TLTVRGLLFPLTKAQYTSMAKMRNLQPKLQDLKERFGDDRQKMGQAMMELYKKEKVNPMG GCLPILLQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYYILPLLMGASMFVMQKM QPIAPTMDPMQVKMMQWMPMIFTVFFLWFPSGLVLYWLVGNIVAIIQQKIIYAGLEKKGL K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Shewana3_0006; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | A0KR32 |
◆ Recombinant Proteins | ||
Cd82-2674M | Recombinant Mouse Cd82 protein, His-SUMO-tagged | +Inquiry |
CACNB3-0273H | Recombinant Human CACNB3 Protein, GST-Tagged | +Inquiry |
TSC22D4-9667M | Recombinant Mouse TSC22D4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASNSD1-915H | Recombinant Human ASNSD1 protein, GST-tagged | +Inquiry |
AES-3479H | Recombinant Human AES, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECOM-4396HCL | Recombinant Human MECOM 293 Cell Lysate | +Inquiry |
ASPH-8644HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
INPP5F-863HCL | Recombinant Human INPP5F cell lysate | +Inquiry |
GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
CPSF3L-7303HCL | Recombinant Human CPSF3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket