Recombinant Full Length Methylobacterium Radiotolerans Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL18241MF |
Product Overview : | Recombinant Full Length Methylobacterium radiotolerans Membrane protein insertase YidC(yidC) Protein (B1LTW1) (1-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylobacterium radiotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-617) |
Form : | Lyophilized powder |
AA Sequence : | MGNDKTNMFVAIGLSLLVLLGWQYFVAGPRMEQQRQIEAQNKAAQQQPPGVTPDGVPSPS PKEGGPAAPAPGTLPTAQGGPVSREAALARSPRVRIETPALSGSIALKGGRVDDVSLKNY HETIDPKSPEIVLFSPAGTETPYYAEFGWVGANAGPLPTNDTLWTSDGKTLSPGMPVTLT WDNGAGLVFKRIIAVDDKYMFTIRDEVENKGSGAITLYPYSLVSRWGKPHTQGYYVLHEG MIGYLGNDGLQEFTYDKLAKEGAYGGANTKGKAWTGVTGGFVGITDKYWAAAAIPDQDTP YTGAFTDRTDGATNVYQASVRGDAVNLAAGASATATQRLFAGAKEVNVINNYEKDLGIKH FDLMIDWGWFFFITKPMFRALDFFYHLFGNFGVSILVVTFCLKLLFLPIANRSYVSMAKM KAVQPEMAAIRERYKDDRMKQQQATMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFIT IEMRHAPFFGWIRDLAAPDPTSIVNLFGLLPFPAPDFVHLGVWPIIMGITMFVQMKMNPA PPDPVQAQIFTFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNL RSTFRRGNGTKAAATKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Mrad2831_3503; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B1LTW1 |
◆ Recombinant Proteins | ||
JOSD1-0360H | Recombinant Human JOSD1 Protein (S2-V202), GST tagged | +Inquiry |
KYAT3-0494H | Recombinant Human KYAT3 Protein, GST-Tagged | +Inquiry |
HIPK3-4764H | Active Recombinant Human HIPK3 Protein, GST-tagged | +Inquiry |
CCBP2-1280M | Recombinant Mouse CCBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPN3-22H | Active Recombinant Human CAPN3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN5-7461HCL | Recombinant Human CLDN5 293 Cell Lysate | +Inquiry |
Broccoli-686P | Broccoli Lysate, Total Protein | +Inquiry |
YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
C1QL4-8141HCL | Recombinant Human C1QL4 293 Cell Lysate | +Inquiry |
ZNF71-2079HCL | Recombinant Human ZNF71 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket