Recombinant Full Length Shewanella Sp. Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL6745SF |
Product Overview : | Recombinant Full Length Shewanella sp. Electron transport complex protein RnfA(rnfA) Protein (Q0HII0) (1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-192) |
Form : | Lyophilized powder |
AA Sequence : | MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLGYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLM SLAFMGFTGLVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Shewmr4_2064 |
Synonyms | rnfA; Shewmr4_2064; Ion-translocating oxidoreductase complex subunit A; Rnf electron transport complex subunit A |
UniProt ID | Q0HII0 |
◆ Recombinant Proteins | ||
MED15-6202HF | Recombinant Full Length Human MED15 Protein, GST-tagged | +Inquiry |
KLK11-928M | Recombinant Mouse KLK11 Protein, His-tagged | +Inquiry |
PITX2-6568C | Recombinant Chicken PITX2 | +Inquiry |
SH-RS04400-5737S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS04400 protein, His-tagged | +Inquiry |
CD40LG-166CAF555 | Recombinant Canine CD40LG Protein, Gly/Pro-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Native Proteins | ||
PROC-269B | Active Native Bovine Protein C | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXF1-3622HCL | Recombinant Human NXF1 293 Cell Lysate | +Inquiry |
ALAS1-8925HCL | Recombinant Human ALAS1 293 Cell Lysate | +Inquiry |
MPZL3-4216HCL | Recombinant Human MPZL3 293 Cell Lysate | +Inquiry |
PIAS2-3203HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
PIK3IP1-1348HCL | Recombinant Human PIK3IP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Shewmr4_2064 Products
Required fields are marked with *
My Review for All Shewmr4_2064 Products
Required fields are marked with *
0
Inquiry Basket