Recombinant Full Length Shewanella Oneidensis Putative Protein-Disulfide Oxidoreductase(So_3870) Protein, His-Tagged
Cat.No. : | RFL35685SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis Putative protein-disulfide oxidoreductase(SO_3870) Protein (Q8EAM8) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MSINEVFRSFKAQPVNQLAKIQAERPIWFVMVGAAIFLILSAIFYFQLFLAMAPCEKCVY IRFSQSCIVIAGLIILINPRNNILKTLGLLLAWYAMIQGWIWSFELMKIHDAAHMVVDES MDFFAAAGDAAGSACSTEPRFPLGLPLDKWLPFEFAPTGGCGEDDWALFGLNMAHYCMIA YATFMVCLAPLTLGWFASFMTDRRNTIVYQTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbI |
Synonyms | dsbI; SO_3870; Putative protein-disulfide oxidoreductase DsbI |
UniProt ID | Q8EAM8 |
◆ Native Proteins | ||
THBS1-31514TH | Native Human THBS1 | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
CPB2-27270TH | Native Human CPB2 | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASGRP4-1477HCL | Recombinant Human RASGRP4 cell lysate | +Inquiry |
MAF1-4563HCL | Recombinant Human MAF1 293 Cell Lysate | +Inquiry |
ATXN10-51HCL | Recombinant Human ATXN10 lysate | +Inquiry |
RNASE10-2324HCL | Recombinant Human RNASE10 293 Cell Lysate | +Inquiry |
DLL4-2495MCL | Recombinant Mouse DLL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbI Products
Required fields are marked with *
My Review for All dsbI Products
Required fields are marked with *
0
Inquiry Basket