Recombinant Full Length Shewanella Amazonensis Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL30726SF |
Product Overview : | Recombinant Full Length Shewanella amazonensis Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A1SAK0) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella amazonensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MTFASLRRGYQVIRTLLHYGLDDVLPPTLLPGYFKLLRLCLFWVRNRHKDKCGGERLKLA MQELGPVYIKFGQMLSTRRDLLSDEWAQELSMLQDRVPAFDSALAREAIEAELKAPIDSL FDDFDDTPLASASISQVHTATLKSNGQQVVLKVLRPNVEANIKADLELMLQVATWVNRLL GEGNRLRPVEVVEDYQNTILGELNLKLEALNATKLRNNFLDSDALYIPYVYEELCHPRLM VMERIDGIPVSDIEALNAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFISREHP ENPFYIGLDCGIMGSLNEEDKRYLAENFLAFFNRDYHRIAQLYVESGWVSADTDILAFEQ AVKLVCEPMFNKPLNEISFGHVLLELFRTARRFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLERWMAEQVGPKAIFKKVQTNLPFWSDKLPEFPELIYDNLKLGRKLLGS QQQMLDRYLKYQQKAHKSNFLLITSAVLLICGTILFAQTDTLWLASACLGSGALVWGAGW RSRPKNRKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Sama_3204; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A1SAK0 |
◆ Recombinant Proteins | ||
CDK5RAP3-335Z | Recombinant Zebrafish CDK5RAP3 | +Inquiry |
GM10670-3631M | Recombinant Mouse GM10670 Protein, His (Fc)-Avi-tagged | +Inquiry |
JUP-2805R | Recombinant Rat JUP Protein, His (Fc)-Avi-tagged | +Inquiry |
KIF14-2360H | Recombinant Human KIF14 Protein, His-tagged | +Inquiry |
MMP11-5245H | Recombinant Human MMP11 Protein, GST/His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-261M | Native Monkey Transferrin | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS19-2169HCL | Recombinant Human RPS19 293 Cell Lysate | +Inquiry |
HFE2-001CCL | Recombinant Cynomolgus HFE2 cell lysate | +Inquiry |
H2AFJ-5662HCL | Recombinant Human H2AFJ 293 Cell Lysate | +Inquiry |
MEMO1-4367HCL | Recombinant Human MEMO1 293 Cell Lysate | +Inquiry |
EVL-6516HCL | Recombinant Human EVL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket