Recombinant Full Length Sheep Type-2 Angiotensin Ii Receptor(Agtr2) Protein, His-Tagged
Cat.No. : | RFL29720OF |
Product Overview : | Recombinant Full Length Sheep Type-2 angiotensin II receptor(AGTR2) Protein (Q28929) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | PVLYYIIWGVGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSHR YDWIFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLG WCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFI ATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVI NSCEVIAVIDLALPFAILLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGTR2 |
Synonyms | AGTR2; Type-2 angiotensin II receptor; Angiotensin II type-2 receptor; AT2; Fragment |
UniProt ID | Q28929 |
◆ Recombinant Proteins | ||
ABO-3794H | Recombinant Human ABO protein, GST-tagged | +Inquiry |
AGTR2-313R | Recombinant Rat AGTR2 Protein (1-45 aa), GST-tagged | +Inquiry |
AGTR2-1321R | Recombinant Rat AGTR2 Protein (1-45 aa), His-tagged | +Inquiry |
AGTR2-397H | Recombinant Human AGTR2 | +Inquiry |
AGTR2-30H | Recombinant Human AGTR2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTR2-8969HCL | Recombinant Human AGTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGTR2 Products
Required fields are marked with *
My Review for All AGTR2 Products
Required fields are marked with *
0
Inquiry Basket