Recombinant Full Length Sheep Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged
Cat.No. : | RFL30477OF |
Product Overview : | Recombinant Full Length Sheep Cytochrome c oxidase subunit 2(MT-CO2) Protein (O78750) (1-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-227) |
Form : | Lyophilized powder |
AA Sequence : | MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLPSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-CO2 |
Synonyms | MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | O78750 |
◆ Recombinant Proteins | ||
NFASC-596H | Recombinant Human NFASC Protein, GST-tagged | +Inquiry |
RPZ4-2626Z | Recombinant Zebrafish RPZ4 | +Inquiry |
Ly6a-1358M | Recombinant Mouse Ly6a protein, His&Myc-tagged | +Inquiry |
DDX52-3861Z | Recombinant Zebrafish DDX52 | +Inquiry |
MYCB-10518Z | Recombinant Zebrafish MYCB | +Inquiry |
◆ Native Proteins | ||
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT4-8537HCL | Recombinant Human B4GALT4 293 Cell Lysate | +Inquiry |
PENK-3298HCL | Recombinant Human PENK 293 Cell Lysate | +Inquiry |
STATH-785HCL | Recombinant Human STATH cell lysate | +Inquiry |
SCGB2B2-2035HCL | Recombinant Human SCGBL 293 Cell Lysate | +Inquiry |
N6AMT2-3995HCL | Recombinant Human N6AMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-CO2 Products
Required fields are marked with *
My Review for All MT-CO2 Products
Required fields are marked with *
0
Inquiry Basket