Recombinant Full Length Sheep C-C Chemokine Receptor Type 9(Ccr9) Protein, His-Tagged
Cat.No. : | RFL4006OF |
Product Overview : | Recombinant Full Length Sheep C-C chemokine receptor type 9(CCR9) Protein (Q1WLP9) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MVPTEATSLILNPSDDYGYDGTPPMEYDTNLTDYFCEKSHVRQFAGHFLPPLYWLVFIVG AVGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLTTLPFWAIAAADQWKFQTFMCKVV NSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAQMWRQKRLLYSKMVCFTIWVMAAALCLP ELLYSQVKEEHGTAICTVVYSSNESTKLKSAVLTLKVTLGFFLPFVVMACCYAIIIHTLI RAKKSSKHKALKVTITVLTVFVLSQFPHNCVLLVQTIDAYATFISSCALSIKIDICFQVT QTVAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLET TSGALSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCR9 |
Synonyms | CCR9; C-C chemokine receptor type 9; C-C CKR-9; CC-CKR-9; CCR-9; CD antigen CDw199 |
UniProt ID | Q1WLP9 |
◆ Recombinant Proteins | ||
CCR9-30H | Recombinant Human CCR9 protein, His-tagged | +Inquiry |
CCR9-716H | Recombinant Human CCR9 | +Inquiry |
CCR9-381C | Recombinant Cynomolgus CCR9 Protein, His-tagged | +Inquiry |
RFL4006OF | Recombinant Full Length Sheep C-C Chemokine Receptor Type 9(Ccr9) Protein, His-Tagged | +Inquiry |
CCR9-1371H | Active Recombinant Human CCR9 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR9 Products
Required fields are marked with *
My Review for All CCR9 Products
Required fields are marked with *
0
Inquiry Basket