Recombinant Full Length Serpentine Receptor Class Epsilon-31(Sre-31) Protein, His-Tagged
Cat.No. : | RFL7900CF |
Product Overview : | Recombinant Full Length Serpentine receptor class epsilon-31(sre-31) Protein (O62266) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MIIKNTGTSTFIWLPVYFYNEPLNLKLVISIFELLSYILCGYILNLSIYVMSKIQLFHKN LMFLTVPLFAIWYELIIGKFITIAYRLKIVNPGVELGEHTVFWTNDPDKILEVGGSSGLE LLIFGGFLQWHTIYSIVFGILAVATERTIASVYIKDYESKKRIWIPIFLIIICQVLAIFM TFIVINRKVHPIIARLPFIFLCPISFAVWLFVKNKNKTLQKEIQNPKRTRIFTLSQQCQV KENLRALRLGTRLVAVVLVYIMVCFLGIVSLTFDLIPGVCGHFVENFLFFHPIPICLTAM FSIPRWKTEFEKSYLPWKYRRNLRKIRQMSMEIEEDSIKKISLETDLYFKQLAESWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sre-31 |
Synonyms | sre-31; F57G9.1; Serpentine receptor class epsilon-31; Protein sre-31 |
UniProt ID | O62266 |
◆ Native Proteins | ||
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
CA2-29D | Native Dog Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP5-4230HCL | Recombinant Human MPP5 293 Cell Lysate | +Inquiry |
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
PRPF3-2827HCL | Recombinant Human PRPF3 293 Cell Lysate | +Inquiry |
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
AP2M1-8814HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sre-31 Products
Required fields are marked with *
My Review for All sre-31 Products
Required fields are marked with *
0
Inquiry Basket