Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yhap(Yhap) Protein, His-Tagged
Cat.No. : | RFL21941BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein yhaP(yhaP) Protein (O07523) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MNKFWIMLSHTYKNKIMAKSFIISTVITVLLVLVVTNLESIISLFQGDDAKEKIAVVDET NELYPVFSKQLKAVDTDGDLDVKLSKQSEDEVTKQVKDESLDGMLIIKRDEKGTISGTYK ALTISDESTYQTLQQALTQTKTAVGTAELGVSQETISSLYAPVTVGQKALKEGAKSEEEL GQTVGLVYIMLFVIYFSVIMYASMIAMEVATEKSSRVMEILISSMPPIQQMFAKLLGIGL VGITQLAIIIGAGSLSLKLNQKSETASSVGGFLNLTDVSATTVIYAVIFFLLGYFLYATL AAFLGSVVSRIEDVQQTITPMTLLVVAGFMIAMFGLNAPDAGFITVTSFIPFFTPMIMFL RVGMLDIPFWQAAVGIGITLLTIVILAVIGARIYKGGVLIYGNSSAFKAIKQALRLAKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yhaP |
Synonyms | yhaP; BSU09900; Uncharacterized protein YhaP |
UniProt ID | O07523 |
◆ Recombinant Proteins | ||
NBAS-3403H | Recombinant Human NBAS protein, His-tagged | +Inquiry |
HA-1899H | Recombinant H5N1 (A/Cambodia/V0401301/2011) HA (ΔTM) Protein, His-tagged | +Inquiry |
RBM14-31045TH | Recombinant Human RBM14, His-tagged | +Inquiry |
RFL34434CF | Recombinant Full Length Citrobacter Koseri Rhomboid Protease Glpg(Glpg) Protein, His-Tagged | +Inquiry |
SIRPA-195H | Recombinant Human SIRPA Protein, His\Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CKM-26522TH | Native Human CKM | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC104-7792HCL | Recombinant Human CCDC104 293 Cell Lysate | +Inquiry |
TRIP13-702HCL | Recombinant Human TRIP13 lysate | +Inquiry |
RNF216-2282HCL | Recombinant Human RNF216 293 Cell Lysate | +Inquiry |
Kidney-138R | Rat Kidney Tissue Lysate | +Inquiry |
RAD51D-2553HCL | Recombinant Human RAD51L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yhaP Products
Required fields are marked with *
My Review for All yhaP Products
Required fields are marked with *
0
Inquiry Basket