Recombinant Full Length Serpentine Receptor Class Epsilon-26(Sre-26) Protein, His-Tagged
Cat.No. : | RFL28950CF |
Product Overview : | Recombinant Full Length Serpentine receptor class epsilon-26(sre-26) Protein (O62489) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MFIKLSSTNSTSIFWLPIFFYNEPYWAQCAISSAELPFYMLSAYVVFVSCRIMLKIQLFH DNLMYIGVPMFGSWFLLIAGKLITILYRVRILNVESVKIHENWVFWTDEPEKMLNVQSLD GLVPLLVAGFLEIHFGFSVIFVGLAIVTERVIASMLIDNYEQSTSLLIPISFIIIYQFLA ISISLGILFNILGLYVLNASWILCILIGTIMYYYIRKINTKWLQEMQNPNRKRVFTVSQQ FQVRENLGAIAIGKRLVFVVLATIVVMGFGIVALVLEITVLFFMHFGENTLFCYPLYIFL VVMNGHPAWKQEFRKYFPKIKIFKKVRPGLVSVEIVEDQKKKLSLETDTYFRQLKSAWT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sre-26 |
Synonyms | sre-26; Y57A10C.4; Serpentine receptor class epsilon-26; Protein sre-26 |
UniProt ID | O62489 |
◆ Recombinant Proteins | ||
PSAT1-5837H | Recombinant Human PSAT1 Protein (Met1-Gly312), N-His tagged | +Inquiry |
F2-7769M | Recombinant Mouse F2 protein, His-tagged | +Inquiry |
GBGT1L1-10654Z | Recombinant Zebrafish GBGT1L1 | +Inquiry |
FASTKD2-1933R | Recombinant Rat FASTKD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
fur-4236E | Recombinant Escherichia coli fur protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
AMBP-27H | Native Human AMBP | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
PTP4A3-2692HCL | Recombinant Human PTP4A3 293 Cell Lysate | +Inquiry |
PABPC1L2A-1270HCL | Recombinant Human PABPC1L2A cell lysate | +Inquiry |
CSNK2B-7237HCL | Recombinant Human CSNK2B 293 Cell Lysate | +Inquiry |
ACVR1C-1277CCL | Recombinant Cynomolgus ACVR1C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sre-26 Products
Required fields are marked with *
My Review for All sre-26 Products
Required fields are marked with *
0
Inquiry Basket