Recombinant Full Length Serpentine Receptor Class Delta-51(Srd-51) Protein, His-Tagged
Cat.No. : | RFL36967CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-51(srd-51) Protein (Q19473) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MSEVEKKLEMFVTVYYSLNVTLALSINILLLFIMKTTKSSLLKDMQYYLFNTALFEIIVS LSTYFAQCRPVANKSTLAVFCHGPCKYFGKNTCFVTFAVVQCSVVAASFSILLSFYYRYR LLKVNFKKKHKHATTFIIFSFFPTVMLLFQLLTDSNFAIVEAETREMHPDYDYVNNALIG FSDSKSPAAIIAQSLISLGVYMSPLIAFHYRRKINKILSTNTGQRIPVAYCKQLINGLLI QTLIPFCVYIPPYSYFLYSQLSGHSNLYFEYLLNIFGSFTAFINPLLTFYFVLPYRRALC KKVFKYFPSISEEGTEITTFPTTVQFQRGHTASTKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-51 |
Synonyms | srd-51; F15A2.3; Serpentine receptor class delta-51; Protein srd-51 |
UniProt ID | Q19473 |
◆ Recombinant Proteins | ||
KLHDC10-4843M | Recombinant Mouse KLHDC10 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPCAM-186CAF488 | Recombinant Monkey EPCAM Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PLP2-4532R | Recombinant Rat PLP2 Protein | +Inquiry |
RFL36151OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Cellulose Synthase-Like Protein E2(Csle2) Protein, His-Tagged | +Inquiry |
ALKBH7-4606H | Recombinant Human ALKBH7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CRP-8057H | Native C-Reactive Protein | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMYD3-2506HCL | Recombinant Human SMYD3 cell lysate | +Inquiry |
PLA2G1B-2200HCL | Recombinant Human PLA2G1B cell lysate | +Inquiry |
IGSF11-1815HCL | Recombinant Human IGSF11 cell lysate | +Inquiry |
ADRM1-8997HCL | Recombinant Human ADRM1 293 Cell Lysate | +Inquiry |
CCRF-CEM-033WCY | Human Acute Lymphoblastic Leukemia CCRF-CEM Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srd-51 Products
Required fields are marked with *
My Review for All srd-51 Products
Required fields are marked with *
0
Inquiry Basket