Recombinant Full Length Serpentine Receptor Class Delta-50(Srd-50) Protein, His-Tagged
Cat.No. : | RFL8359CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-50(srd-50) Protein (Q19474) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MMSAMETNMVLILTIFYNAYFLLAISSQLLLLYLMLKCQNRSLHEMRIYLFNILGLQFIS TFSAFVLQCRLKRVTLKHFCRIVPSSGTVAMLCYGPCKYLGNIVCEVLFHILQTSLNACA TALIIAFYYRYEMLTNNSFTRSGHYKQLVISYCVPLVFLICEVLSPNDVNKLVAELTVLH PTYGLENYAILGFSDVKTVAASSQTLMLMIGLYGTPFIALVFRKKIIKILHSSRSYHAEK IVQTKSMIQGLTLQTLLPLICYCPGFTYYIYSQYTQSSSLFVEFAVSPYGFVYTIFDPLL TIYYVLPYRRTFKAIFSKHNSTTSATFVHSETARRVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-50 |
Synonyms | srd-50; F15A2.4; Serpentine receptor class delta-50; Protein srd-50 |
UniProt ID | Q19474 |
◆ Recombinant Proteins | ||
Pradc1-5092M | Recombinant Mouse Pradc1 Protein, Myc/DDK-tagged | +Inquiry |
PI4K2B-2827C | Recombinant Chicken PI4K2B | +Inquiry |
FAP-370CAF555 | Active Recombinant Monkeys FAP Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
FAM161B-5515M | Recombinant Mouse FAM161B Protein | +Inquiry |
RFL1073MF | Recombinant Full Length Mycoplasma Gallisepticum Probable Glycerol Uptake Facilitator Protein(Glpf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGG -36D | Native Canine Fibrinogen | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1A1-8932HCL | Recombinant Human AKR1A1 293 Cell Lysate | +Inquiry |
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
ATG5-8622HCL | Recombinant Human ATG5 293 Cell Lysate | +Inquiry |
ABAT-9154HCL | Recombinant Human ABAT 293 Cell Lysate | +Inquiry |
RPL13-2225HCL | Recombinant Human RPL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srd-50 Products
Required fields are marked with *
My Review for All srd-50 Products
Required fields are marked with *
0
Inquiry Basket