Recombinant Full Length Serpentine Receptor Class Delta-44(Srd-44) Protein, His-Tagged
Cat.No. : | RFL3941CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-44(srd-44) Protein (O17823) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MFRKILSVLNPTVFVLSLCFQIILIYTIIRHSPKNLSTLKAILLTNCCFQLLQSSMVFFT QIQLVNHLVPIELWSYGPCRHFEAFMCYSMFHILQTSSLVSGLTVFLTTFMKYQAARHVR PSKKKNCFVILFISSIVLISAGCGILLVIIQALPLEIREKYYRINLELDEYSVIGIVDYS VLPSRVNGIIINGLVVIVPITCLLLRRKILKLLTASSDALYFQNRVFLQGLTLQIFGHTL VYVPIFICSTISLITKTEYTFAQFFIFVLPHLTTVIDPLLTMYFVTPYRKRLMVWLRLKN DKVHSVSPSTFAVSANH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-44 |
Synonyms | srd-44; F17A2.8; Serpentine receptor class delta-44; Protein srd-44 |
UniProt ID | O17823 |
◆ Recombinant Proteins | ||
RFL18479HF | Recombinant Full Length Helicobacter Pylori Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
KLHL32-1525H | Recombinant Human KLHL32 | +Inquiry |
OPN1SW2-8796Z | Recombinant Zebrafish OPN1SW2 | +Inquiry |
Gpx5-1107R | Recombinant Rat Gpx5 protein, His-tagged | +Inquiry |
SH-RS08610-5360S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS08610 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
FGA-34D | Native Canine Fibrinogen | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
Uterus-679H | Hamster Uterus Lysate, Total Protein | +Inquiry |
HS578T-004WCY | Human Breast Carcinoma HS578T Whole Cell Lysate | +Inquiry |
ACTB-20HCL | Recombinant Human ACTB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srd-44 Products
Required fields are marked with *
My Review for All srd-44 Products
Required fields are marked with *
0
Inquiry Basket