Recombinant Full Length Serpentine Receptor Class Alpha-33(Sra-33) Protein, His-Tagged
Cat.No. : | RFL22567CF |
Product Overview : | Recombinant Full Length Serpentine receptor class alpha-33(sra-33) Protein (Q10935) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MNIISDKEILEVRTSQVFRFSVYFIDTSCIISMAVTVLAIFQLHSKQVFNPSTTRLLITD LVFINIHNLSYIFLQNWSLFRSFFYQTANDIMFKSEECWPHHVTNEFTKVVTVFNQFALI INRISVTIDSKRFSHANYGFLLAILSLIASTVFTAQQHFLGPIHGMRTTSCFRESDVVLD LKTEHIIPYLAICLTSIVCSLLLIIYVKKTQKTKTYDIESEYTKKEAVVSSISVAILGII QLVLFCFYDTFLTIFAKLTAENPNVHDTNIIGWFYTSPLNAIISPTAVFLYISWIKKNRQ MHIRKMTKVNKSENGCHFQQLSVMWNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sra-33 |
Synonyms | sra-33; B0304.6; Serpentine receptor class alpha-33; Protein sra-33 |
UniProt ID | Q10935 |
◆ Recombinant Proteins | ||
Vash1-6898M | Recombinant Mouse Vash1 Protein, Myc/DDK-tagged | +Inquiry |
Spike-217V | Recombinant SARS-CoV S protein RBD, His-tagged (MALS verified) | +Inquiry |
ILDR2-029H | Active Recombinant Human ILDR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
AYP1020-RS10060-4817S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS10060 protein, His-tagged | +Inquiry |
PTGS2A-9464Z | Recombinant Zebrafish PTGS2A | +Inquiry |
◆ Native Proteins | ||
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR172B-5793HCL | Recombinant Human GPR172B 293 Cell Lysate | +Inquiry |
STMN4-1394HCL | Recombinant Human STMN4 293 Cell Lysate | +Inquiry |
MTFR1-1144HCL | Recombinant Human MTFR1 cell lysate | +Inquiry |
GPX2-5762HCL | Recombinant Human GPX2 293 Cell Lysate | +Inquiry |
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sra-33 Products
Required fields are marked with *
My Review for All sra-33 Products
Required fields are marked with *
0
Inquiry Basket