Recombinant Full Length Serpentine Receptor Class Alpha-28(Sra-28) Protein, His-Tagged
Cat.No. : | RFL20334CF |
Product Overview : | Recombinant Full Length Serpentine receptor class alpha-28(sra-28) Protein (Q19550) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-341) |
Form : | Lyophilized powder |
AA Sequence : | MSSECARSDVHNVLTSDSMKFNHCFIISIIIISFFTTTKSVRVLLKQNLLPTCTRNLLFS AIINGIIHQCVTAVIRLRAFYHAIVYASDPCAILFQSSQCFFDGNLYYYTNLFSSFCCFS LFLDRLFSFKPRSSYHNHQTLASIVLILSQIVLPIGPLYWVFYDAFYTSYVLMCTYPPPM SVMKLHEVNNIRICVLIVLLFFAIFLYIHNKIREKRMVHNVYNINSRYKSYENYLATKSV CIVIFSQILCVGPTSSITSVFIRFRDSIPLEWFHLIISYLTGLTYSNFLLPLIILYQDKQ IAKKRRIMIQRLQNKNETSFDHFDTLKSLWGKKTGNQETLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sra-28 |
Synonyms | sra-28; F18C5.6; Serpentine receptor class alpha-28; Protein sra-28 |
UniProt ID | Q19550 |
◆ Recombinant Proteins | ||
RTN1-157H | Recombinant Human RTN1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF2-875R | Recombinant Rhesus Macaque CSF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTLA-567H | Active Recombinant Human BTLA Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
Ppp1r3a-1968R | Recombinant Rat Ppp1r3a Protein, His-tagged | +Inquiry |
NOL8-5058Z | Recombinant Zebrafish NOL8 | +Inquiry |
◆ Native Proteins | ||
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon ascending-78C | Cynomolgus monkey Colon ascending Lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
CXorf38-209HCL | Recombinant Human CXorf38 lysate | +Inquiry |
Hippocampus-238C | Cynomolgus monkey Hippocampus Lysate | +Inquiry |
TRIM63-1833HCL | Recombinant Human TRIM63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sra-28 Products
Required fields are marked with *
My Review for All sra-28 Products
Required fields are marked with *
0
Inquiry Basket