Recombinant Full Length Serpentine Receptor Class Alpha-24(Sra-24) Protein, His-Tagged
Cat.No. : | RFL25711CF |
Product Overview : | Recombinant Full Length Serpentine receptor class alpha-24(sra-24) Protein (O62368) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MNKTAEEIVESRRCASEGLTNALTSITVKMSSVLVVTVILLSYYFARLAIRTLWKNNIFS NSTRLILLVCLLNSIIHQTTMLEIRIRQIYRSIVFASEPCRLPFHFTECEVELFVYYLTT YFSTYSVFSLAFDRLISCYTPKYYLSHQYYVSIFLLFIQLIFTLGTYYVGLYGVPPLGYE PFCNYAPKLATNFVKINDFRTLIMGICIIVTVFVYYLSVKSEKQIQQTSYSPGERYIAYE NVAASQSVCILIVLQFACILISSLGVNYLRIFKSTLSDEEYNKLAPFFVGVTYANLCLPL VIHCKTKLTIRNRKLRIGVMTSMYGDVGEHINRLKKSWE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sra-24 |
Synonyms | sra-24; T06G6.2; Serpentine receptor class alpha-24; Protein sra-24 |
UniProt ID | O62368 |
◆ Recombinant Proteins | ||
RFL15264PF | Recombinant Full Length Prochlorococcus Marinus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
RFL-30829MF | Recombinant Full Length Mouse Amyloid-Like Protein 1(Aplp1) Protein, His-Tagged | +Inquiry |
ICA1-3060H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
IL13-335H | Recombinant Human IL13 Protein, His/DDK-tagged | +Inquiry |
KAT2B-2828H | Recombinant Human KAT2B protein, His&FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
A1m-367M | Native Mouse A1m | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3-396HCL | Recombinant Human CREB3 cell lysate | +Inquiry |
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
BBS12-248HCL | Recombinant Human BBS12 cell lysate | +Inquiry |
AMY1B-8874HCL | Recombinant Human AMY1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sra-24 Products
Required fields are marked with *
My Review for All sra-24 Products
Required fields are marked with *
0
Inquiry Basket