Recombinant Full Length Sensor-Type Histidine Kinase Prrb(Prrb) Protein, His-Tagged
Cat.No. : | RFL34790HF |
Product Overview : | Recombinant Full Length Sensor-type histidine kinase prrB(prrB) Protein (P0A5Z8) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFA IPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTV EIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLA EQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA TLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLENSPLGGARLVLRLPGPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sensor-type histidine kinase prrB(prrB) |
UniProt ID | P0A5Z8 |
◆ Recombinant Proteins | ||
DNMT3L-166H | Active Recombinant Human DNMT3L, GST-tagged | +Inquiry |
PPP2R2A-4293R | Recombinant Rat PPP2R2A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6237DF | Recombinant Full Length Debaryomyces Hansenii Mitochondrial Import Inner Membrane Translocase Subunit Tim22(Tim22) Protein, His-Tagged | +Inquiry |
ZBTB43-3783H | Recombinant Human ZBTB43, GST-tagged | +Inquiry |
PIGF-456H | Recombinant Human PIGF | +Inquiry |
◆ Native Proteins | ||
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
UTS2D-1900HCL | Recombinant Human UTS2D cell lysate | +Inquiry |
CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry |
KIAA1958-4957HCL | Recombinant Human KIAA1958 293 Cell Lysate | +Inquiry |
NUMB-3634HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
LMAN1-4719HCL | Recombinant Human LMAN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sensor-type histidine kinase prrB(prrB) Products
Required fields are marked with *
My Review for All Sensor-type histidine kinase prrB(prrB) Products
Required fields are marked with *
0
Inquiry Basket