Recombinant Full Length Sensor Protein Dlts(Dlts) Protein, His-Tagged
Cat.No. : | RFL9866SF |
Product Overview : | Recombinant Full Length Sensor protein dltS(dltS) Protein (Q8DXQ8) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus agalactiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MFSDLRKKFVFLTMSILIVVVLFLFAVSNRYNQYWDEYDAYRIVKLVAKNDYLGIPGDEP IALVTIDNQKMVKIQSNNTDLTNDVIEKSSLKLLEQGKKSRKWKSFIYSIKEYKDKTYTI AIMDLASYEVPYARRFLILVFTIFGFCLLAAVSLYLSRFIVGPVETEMTREKQFVSDASH ELKTPIAAIRANVQVLEQQIPGNRYLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKK LNLSVLCQEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSK SAIQFSLKQARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHADSLSFGLGLSIAKAI VERHKGRIRAYQEKDQLRLEVQLPIDGFWTNTMIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dltS |
Synonyms | dltS; SAG1791; Sensor protein DltS |
UniProt ID | Q8DXQ8 |
◆ Recombinant Proteins | ||
GBP5-970H | Recombinant Human GBP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAT-241H | Recombinant Human AADAT Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14129OF | Recombinant Full Length Oceanobacillus Iheyensis Cardiolipin Synthase(Cls) Protein, His-Tagged | +Inquiry |
TMEM186-6143R | Recombinant Rat TMEM186 Protein | +Inquiry |
DHX16-10382Z | Recombinant Zebrafish DHX16 | +Inquiry |
◆ Native Proteins | ||
Factor B-60H | Native Human Factor B | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK7-5029HCL | Recombinant Human KCNK7 293 Cell Lysate | +Inquiry |
RAB37-2602HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
SMCO1-8043HCL | Recombinant Human C3orf43 293 Cell Lysate | +Inquiry |
COG2-7385HCL | Recombinant Human COG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dltS Products
Required fields are marked with *
My Review for All dltS Products
Required fields are marked with *
0
Inquiry Basket