Recombinant Full Length Sensor Protein Csec(Csec) Protein, His-Tagged
Cat.No. : | RFL27569SF |
Product Overview : | Recombinant Full Length Sensor protein CseC(cseC) Protein (Q82EB2) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces avermitilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MRGNLRRPGPAGTAGPGRTGIRTSADGGRARPRTGAGTGVRAGVRSGVVGVGAGIRTGVR WKISAAIALVGALVALALSLVVHNAARVSMLDNARDLADERIQVAERMYEAGRAQSFGVK LDDPAIPRDLMMKVTQGRRATYVADGPHGVPDIWAAVPLKDGRVLSLHTRFTDRSADIMK DLDQALIIGSIAVVFGGSALGVLIGGQLSRRLRKAAAAANQVAQGERDVRVRDAIGGVVR DETDDLARAVDAMADALQQRIEAERRVTADIAHELRTPVTGLLTAAELLPPGRPTELVRD RAQAMRTLVEDVLEVARLDGASERAELQDIMLGEFVSRRVAAKDADIEVRVVHESEVTTD PRRLERVLFNLLANAARHGKPPIEVSVEGRVIRVRDHGPGFPEELLADGPRRFRTGSTDR AGHGHGLGLTIAAGQARVLGARLTFRNVRPAGAPGDVPAEGAVAVLWLPEHAPTNTGSFP MLPLSGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cseC |
Synonyms | cseC; SAV_4703; Sensor protein CseC |
UniProt ID | Q82EB2 |
◆ Recombinant Proteins | ||
POLR2F-154H | Recombinant Human POLR2F, His-tagged | +Inquiry |
RFL32520VF | Recombinant Full Length Vibrio Fischeri Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
RECQL-809H | Recombinant Human RECQL Protein, MYC/DDK-tagged | +Inquiry |
MAPK8IP1-378H | Recombinant Human MAPK8IP1 Protein, MYC/DDK-tagged | +Inquiry |
RFL6206CF | Recombinant Full Length Cuscuta Reflexa Cytochrome B5 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5RA-2060HCL | Recombinant Human IL5RA cell lysate | +Inquiry |
MSC-422HCL | Recombinant Human MSC lysate | +Inquiry |
ARPC3-37HCL | Recombinant Human ARPC3 lysate | +Inquiry |
HSPB7-5346HCL | Recombinant Human HSPB7 293 Cell Lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cseC Products
Required fields are marked with *
My Review for All cseC Products
Required fields are marked with *
0
Inquiry Basket