Recombinant Full Length Sensor Kinase Cuss(Cuss) Protein, His-Tagged
Cat.No. : | RFL18195EF |
Product Overview : | Recombinant Full Length Sensor kinase CusS(cusS) Protein (Q8XBY4) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER VLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGAPDIREFARDAIPDKDA RGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKPIYTLYIALSIDFHLHYI NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL QFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVVRCQTVDHLVQVIVENPGTPIA PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSNARGTRFVIVLPE RG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cusS |
Synonyms | cusS; Z0708; ECs0608; Sensor histidine kinase CusS |
UniProt ID | Q8XBY4 |
◆ Native Proteins | ||
CA2-33R | Native Rat Carbonic Anhydrase II (CA2) Protein | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAIAP2-8521HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
TMEM133-1005HCL | Recombinant Human TMEM133 293 Cell Lysate | +Inquiry |
HepG2-163H | HepG2 Whole Cell Lysate | +Inquiry |
UHRF1-508HCL | Recombinant Human UHRF1 293 Cell Lysate | +Inquiry |
KRT18-4877HCL | Recombinant Human KRT18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cusS Products
Required fields are marked with *
My Review for All cusS Products
Required fields are marked with *
0
Inquiry Basket