Recombinant Full Length Sensor Kinase Cuss(Cuss) Protein, His-Tagged
Cat.No. : | RFL31062EF |
Product Overview : | Recombinant Full Length Sensor kinase CusS(cusS) Protein (Q8FK37) (1-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-480) |
Form : | Lyophilized powder |
AA Sequence : | MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER VLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGAPDIREFTRDAIPDKDA QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL RFVGDECQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVTVENPGTPIA PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDVRGTRFVIILPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cusS |
Synonyms | cusS; c0656; Sensor histidine kinase CusS |
UniProt ID | Q8FK37 |
◆ Recombinant Proteins | ||
PNPLA6-1819H | Recombinant Human PNPLA6, His-tagged | +Inquiry |
HNRNPH3-1946R | Recombinant Rhesus Macaque HNRNPH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAH-4250H | Recombinant Human YWHAH protein, His-tagged | +Inquiry |
NAF1-3050H | Recombinant Human NAF1 protein, His-tagged | +Inquiry |
RFL30642YF | Recombinant Full Length Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRA5-6063HCL | Recombinant Human GABRA5 293 Cell Lysate | +Inquiry |
AAGAB-631HCL | Recombinant Human AAGAB cell lysate | +Inquiry |
ELTD1-6613HCL | Recombinant Human ELTD1 293 Cell Lysate | +Inquiry |
INO80B-5202HCL | Recombinant Human INO80B 293 Cell Lysate | +Inquiry |
GAS2L3-688HCL | Recombinant Human GAS2L3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cusS Products
Required fields are marked with *
My Review for All cusS Products
Required fields are marked with *
0
Inquiry Basket