Recombinant Full Length Schizosaccharomyces Pombe Vacuolar Atpase Assembly Integral Membrane Protein Vph2(Vph2) Protein, His-Tagged
Cat.No. : | RFL33343SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Vacuolar ATPase assembly integral membrane protein vph2(vph2) Protein (O74920) (1-186aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-186) |
Form : | Lyophilized powder |
AA Sequence : | MLKELRLHNRNINFLEFLRGVQIVPSDSVFLGEIDENSHTQDNTTTSILKEKELYDGIPL LPSMAGVSMDPEREKKSELRLMKNQISAIINILFTVVGTVTAVWYCTSSLSIEKKIALCA FSAILVLVADTFLYVRYLSAQPVRTSKNHTRQIIYTWTTNDPVLQSNEQLAIELGAIPSL KEKKNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vph2 |
Synonyms | vph2; SPCC757.10; Vacuolar ATPase assembly integral membrane protein vph2 |
UniProt ID | O74920 |
◆ Native Proteins | ||
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
Fixa-280B | Active Native Bovine Factor IXa - DEGR | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAS-2419MCL | Recombinant Mouse FAS cell lysate | +Inquiry |
DPPA3P2-640HCL | Recombinant Human DPPA3P2 lysate | +Inquiry |
TMEM167A-994HCL | Recombinant Human TMEM167A 293 Cell Lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
DMC1-6900HCL | Recombinant Human DMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All vph2 Products
Required fields are marked with *
My Review for All vph2 Products
Required fields are marked with *
0
Inquiry Basket