Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Serine-Rich Protein C11G7.01 (Spac11G7.01) Protein, His-Tagged
Cat.No. : | RFL35189SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized serine-rich protein C11G7.01 (SPAC11G7.01) Protein (O13695) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MSFTNNTSSVDTSLSSSASSSIPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSS SSSSPLSSSSFTSPASSSFITSLVSSSSQQSSSSSASLTSSSSATLTSSSSASPTSSSSS HALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSSSSYHSSSMTTSGLSSSASIVSSTYRD GPSIITLVSTSYVSEVVTPTTTNNWNSSSSFTSSTSSTPISSSYSSSGTLPSKSNKSSNH VGVVVGCSVAIPVGVVLILIGLGIFLWKRHQRSKRIKAERMQEVEEYGFNPNQPSNFRSP NRAPSTNNRYRGWNGSPTPAAGNNTNGRPVAPRPSAGAGGANPPAASQPGLLGGSSNSAG PIAAATAAGVGADASDAANTGGSFTRPQGARMVRPIGNPPDLSASNEAEATMPPSNGSNF SEGLSASPFESGPAVGAAGAAAEAAEHSGSGSDSYPEGPLATIPESDSESMASDLAGESS YGSRAALSSRSQSNLLSPTSTGASNQPNYSPFADNPSSSNVSIPRSSSEARRLNLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC11G7.01 |
Synonyms | SPAC11G7.01; Uncharacterized serine-rich protein C11G7.01 |
UniProt ID | O13695 |
◆ Recombinant Proteins | ||
IL1A-2036H | Recombinant Human IL1A protein, His-tagged | +Inquiry |
GRA7-893T | Recombinant Toxoplasma gondii GRA7 protein | +Inquiry |
POLR1B-13087M | Recombinant Mouse POLR1B Protein | +Inquiry |
IL13-29107TH | Recombinant Human IL13 | +Inquiry |
RFL19086SF | Recombinant Full Length Salmonella Typhimurium Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ELN-01H | Active Native Human ELN Protein | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
STAMBPL1-1426HCL | Recombinant Human STAMBPL1 293 Cell Lysate | +Inquiry |
Adipose-4R | Rat Adipose Membrane Lysate | +Inquiry |
EZH1-6488HCL | Recombinant Human EZH1 293 Cell Lysate | +Inquiry |
LAMC1-4827HCL | Recombinant Human LAMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC11G7.01 Products
Required fields are marked with *
My Review for All SPAC11G7.01 Products
Required fields are marked with *
0
Inquiry Basket