Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein P27G11.14C(Spap27G11.14C) Protein, His-Tagged
Cat.No. : | RFL26282SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein P27G11.14c(SPAP27G11.14c) Protein (Q9P7M4) (1-689aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-689) |
Form : | Lyophilized powder |
AA Sequence : | MNLLSHQLRDRFPIKAIISKADEVIFANYKHTNDFFKITATTYALINSVIVSNNCCNRRF HSTWQKKKHDDLTATVPVIDFRKNQKLTSIVVNAIQAIYWYARRSNCLTGINEAEYIWKS LIPESIFYHFVSLQSFIRKYLTDVFYCSAQKVILLSTDDSVVSSEKLYIRIASILSNAND KVSFKESSINTNTVFKDVYVEVSSHNDEFLLKNSSKCWAFTSLLVDPLHFMFSQIVFEDL SGKKIMKFEDTAVSTASNHSKQFTKGNLLAIKYIGGLYNAVYLMGLKKNLLAFVENEKDD LFVAKIFLLAYSSSKNRKKIVPVDVWDAMIDSLYETINVEETKKETYKFTRSIKTVIPNK LISNESISILSIPESEKTIYQNFDLYVSKFNVARKELSEKELFNNSFSSSFNTLLASLLV KPTLCLISYLMIAKKMVVLQEANRLFLKSFAHPFHLERYHLHAVAAMGGLYQIMSSTHLK NLFFCSRKGIALTKLHSQQYNESTLFQYLSEFVHQRQKSLTPKQRIAIQELILKFMQRNF ENSLYHQSFSSHWFISRLLINPIRMLCWHITDVGKTLDLGEAEKLLKYNHKQCPYIIYPS SLKAVQKLGGLQCIIRNDNLSHIFNCSRKYIRVQRYSDDDLSESSLLPRLVNLLLFFENS MGEVAWNKLSQTLMDMFEKETKSNSLSDY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAP27G11.14c |
Synonyms | SPAP27G11.14c; Uncharacterized protein SPAP27G11.14c |
UniProt ID | Q9P7M4 |
◆ Recombinant Proteins | ||
RFL19638GF | Recombinant Full Length Chicken Frizzled-7(Fzd7) Protein, His-Tagged | +Inquiry |
RFL24037EF | Recombinant Full Length Escherichia Coli O81 Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
N-255M | Recombinant MERS-CoV N Protein, His-SUMO-tagged(N-ter) | +Inquiry |
HAUS6-3071C | Recombinant Chicken HAUS6 | +Inquiry |
MTLD-1275B | Recombinant Bacillus subtilis MTLD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C17orf28-8240HCL | Recombinant Human C17orf28 293 Cell Lysate | +Inquiry |
TIMELESS-1074HCL | Recombinant Human TIMELESS 293 Cell Lysate | +Inquiry |
NOA1-8035HCL | Recombinant Human C4orf14 293 Cell Lysate | +Inquiry |
MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry |
HSD17B8-5371HCL | Recombinant Human HSD17B8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAP27G11.14c Products
Required fields are marked with *
My Review for All SPAP27G11.14c Products
Required fields are marked with *
0
Inquiry Basket