Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C737.03C (Spcc737.03C) Protein, His-Tagged
Cat.No. : | RFL23884SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C737.03c (SPCC737.03c) Protein (O13681) (1-615aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-615) |
Form : | Lyophilized powder |
AA Sequence : | MESSRLFTLGLGNSDDGLKSTFGDKTVTCFYCNKKKEKIRDGTSTWTCSICEATNHIDEK GDILDYRPPTPTQDKGVGPFYAIRDFPSSSSFQSPFCEKCQMNQLIVNRMLADYLPDSSH PDYQAYEKALPEYKKSIEEKFPIVCSECYDSVQDQLDANDYEAKNQVLGYWLQKSKEQLN AKVPHHYPKASFVLWLLRGFGFSFFYLQSIVWHLYHSMIISLLPDGIRNLFLKAISYFLL DGSSSKIFYFNWLGFFVVFWNPYWYKMMDNPSWELFGRDQYIQCQALYLIIRLTCLYLLS CYESEILNLSSDTNLESDFLLRQIHAAFFFVTICFTWISISCLKPSPPPEVHLTGEILKP RKKRQESTSSVHRIGKESSDRKDGISGQNKLQQFATISILNNTNATSHLGNQSVRERAPE ESPMTFLQKKMAALPTSSPVRPMLKPTLQLQNSPLSKLVPQEVGNKVNDSIHTTSNQPSK FSLNPSISLKGDNVIEKNLPFSVSTLKSTAKKDTGKAGDGQNREIQNEPVSLESHFSKSL ALQNDPTEVIQVKNVLHRNRRNAKLLIAFTILFLVGLICGWRLNRFTMFIYYLCILVLAT YYVMKHNFYPLRKVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IMA1 |
Synonyms | IMA1; SPCC737.03c; Integral inner nuclear membrane protein ima1 |
UniProt ID | O13681 |
◆ Recombinant Proteins | ||
S1-328H | Active Recombinant Human betacoronavirus S1, His-tagged | +Inquiry |
S100b-2570M | Recombinant Mouse S100b protein, His-tagged | +Inquiry |
Cxcl16-85M | Recombinant Mouse Cxcl16 protein | +Inquiry |
FUCA1-7730H | Recombinant Human FUCA1 protein, His & T7-tagged | +Inquiry |
FDX1-2624B | Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
GFAP-526H | Native Human GFAP protein | +Inquiry |
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX13-3292HCL | Recombinant Human PEX13 293 Cell Lysate | +Inquiry |
NUP85-3628HCL | Recombinant Human NUP85 293 Cell Lysate | +Inquiry |
GAS8-6015HCL | Recombinant Human GAS8 293 Cell Lysate | +Inquiry |
DUSP4-6774HCL | Recombinant Human DUSP4 293 Cell Lysate | +Inquiry |
C14orf166-8281HCL | Recombinant Human C14orf166 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All IMA1 Products
Required fields are marked with *
My Review for All IMA1 Products
Required fields are marked with *
0
Inquiry Basket