Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C57A10.07 (Spac57A10.07) Protein, His-Tagged
Cat.No. : | RFL7258SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C57A10.07 (SPAC57A10.07) Protein (P87055) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MLNKRLTIQLPFYATQTASSSRFWRVLSPKSRTGIALYASLILLCIFFTIFSTMSHPSLQ CFSPTSLVGAQPLKNLTHLIIVAGHAVWLGGSTNGEDDSEWILEPYQKGEGKVFAQHVRS GLDLLSQDDSSLLVFSGGQTRNGAGPSSEAQSYYSLSMQINSDEGLAARRTTEEFARDSL ENVLFSVARFYEVTSRYPQKITVVSFDFKRDRFLNLHRKAIKFPEHKFHFVGIDPEGGVS DATREAERKNAIIPFTEDPYACSNPLLVKKRMERNPFRRQHSYLITCPELIPLLQYCPSD PSKFFNGKLPW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC57A10.07 |
Synonyms | SPAC57A10.07; Uncharacterized protein C57A10.07 |
UniProt ID | P87055 |
◆ Recombinant Proteins | ||
TSLP-258H | Recombinant Human TSLP Protein | +Inquiry |
CDK5R1-11051H | Recombinant Human CDK5R1 protein, His-tagged | +Inquiry |
KAT7-6956H | Recombinant Human KAT7 , GST-tagged | +Inquiry |
LSM5-5227M | Recombinant Mouse LSM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KDR-245M | Recombinant Mouse KDR Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASAL3-279HCL | Recombinant Human RASAL3 lysate | +Inquiry |
Uterus-763B | Bovine Uterus Membrane Lysate, Total Protein | +Inquiry |
VCL-900MCL | Recombinant Mouse VCL cell lysate | +Inquiry |
Liver-286G | Guinea Pig Liver Lysate | +Inquiry |
SERINC3-1943HCL | Recombinant Human SERINC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC57A10.07 Products
Required fields are marked with *
My Review for All SPAC57A10.07 Products
Required fields are marked with *
0
Inquiry Basket