Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C23C11.17 (Spac23C11.17) Protein, His-Tagged
Cat.No. : | RFL25306SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C23C11.17 (SPAC23C11.17) Protein (O13920) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MKYPRTHIQFPSMLRNRLFKTPHQTGFQWRLGAPATGITIRNQPIRSYSGLRGNFLIDKR LSPVKFNKYSPSDIVFYNIGSSRLYSTETPTPSKVKEAPKQVAAEETKPTTVVKKPSIWQ RVKGGVLHFWDGTKLLGVEIKISSKLVYKMAVGYELTRRESRQLTRTLKDIGRLVPFSVF VVVPFAELLLPIAVKLFPNLLPSTFEDAKDKEAKKAQLRKTRNEVSNMLRSTLKSGKFTF SNETRESKEFRDFFQKVRTSGQSPSREELIEVCKYFKDDITLDNLSRAQLVAMCRYMNLN AFGTDPLLRYNIRHRMRQIRRDDRAIYIEGINSLSIPELFNACNSRGIRTQGLSPAKLKE ELSVWLDMRIKHGIPSVILMLSNAFSYGYNEGTYDSRWDALQDTLASIPDELYHETVVDM PTKQVSNKERLEILREQEELIEEEAEHVAEHPDLAKKQTEENKATSKPAVSAKSPESNIP KNERK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdm28 |
Synonyms | mdm28; SPAC23C11.17; LETM1 domain-containing protein mdm28, mitochondrial |
UniProt ID | O13920 |
◆ Recombinant Proteins | ||
BLOC1S4-2421M | Recombinant Mouse BLOC1S4 Protein | +Inquiry |
FARSA-1643R | Recombinant Rhesus monkey FARSA Protein, His-tagged | +Inquiry |
MYOZ1-15907H | Recombinant Human MYOZ1, His-tagged | +Inquiry |
RFL28983CF | Recombinant Full Length Citrus Unshiu Defender Against Cell Death 1(Dad1) Protein, His-Tagged | +Inquiry |
FGF55-5255H | Recombinant Human FGF55 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
ZC3H12A-745HCL | Recombinant Human ZC3H12A lysate | +Inquiry |
SIGLEC10-1849HCL | Recombinant Human SIGLEC10 293 Cell Lysate | +Inquiry |
ARHGAP12-108HCL | Recombinant Human ARHGAP12 cell lysate | +Inquiry |
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdm28 Products
Required fields are marked with *
My Review for All mdm28 Products
Required fields are marked with *
0
Inquiry Basket