Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C1604.06C (Spbc1604.06C) Protein, His-Tagged
Cat.No. : | RFL484SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C1604.06c (SPBC1604.06c) Protein (O94372) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MIKDLENEIYKSRKNLNNILVLFDYIDLSNHSIDEVNDAAAALCRVYCYLSRNGLLKRPK EDDSSANAQVKNWVCDNYINYTEKLTEIFSMANVEALQVSFLTMTMRLCKAESQMDENGT FRNQFYIRFCLELLSSSQLSDICIKDFVTSYLVPYDDVRFFFYKNSKKVISSLIESSKTD DPMANLDIVAFNTIRILSAIPSPLPSSSTSSWADEPSPSSTETSSIKRAFQESWLSALSL PLSVNLYKQVLNVIHKRVIPFLQKPNLLMDFLTDAYNSHHAVSLLALNGLFTLMISHNLD YPLFYPKLYALLDRNLLYLKTRSRFFRLLDLFLSSTHLPATLIASFIKRLARLALTAPPG AIAIVIPFIYNCLQRHPTCMQMLHRSSAESGDSFDFDQPDPLLTGAIESSLWELSTLQNH YYSNIASLASIMSQKFTKPRYELEDFLDHGYATMCDAELRRPLKNEPPIEFEKRTLASGL EKSWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC1604.06c |
Synonyms | SPBC1604.06c; Uncharacterized protein C1604.06c |
UniProt ID | O94372 |
◆ Recombinant Proteins | ||
NDUFAF2-1230H | Recombinant Human NDUFAF2, His-tagged | +Inquiry |
ACLY-9291H | Recombinant Human ACLY protein, GST-tagged | +Inquiry |
PNOC-3311R | Recombinant Rhesus Macaque PNOC Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS1-422Z | Recombinant Zebrafish DHRS1 | +Inquiry |
FGF17-3231M | Recombinant Mouse FGF17 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAB17737 | Rabbit Anti-TELO2 Polyclonal Antibody | +Inquiry |
Occipital Lobe-36H | Human Occipital Lobe Tissue Lysate | +Inquiry |
Brain-50M | Mouse Brain Membrane Lysate | +Inquiry |
Parietal Lobe-376C | Cynomolgus monkey Parietal Lobe Lysate | +Inquiry |
SMS-1651HCL | Recombinant Human SMS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC1604.06c Products
Required fields are marked with *
My Review for All SPBC1604.06c Products
Required fields are marked with *
0
Inquiry Basket