Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C11B10.07C(Pi004, Spactokyo_453.33C, Spbc11B10.07C) Protein, His-Tagged
Cat.No. : | RFL21881SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C11B10.07c(pi004, SPACTOKYO_453.33c, SPBC11B10.07c) Protein (Q96WW4) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MSQTEIVKKPKHKRFKRPDKSRFVQQTLPAWQFIFTPWTVLPLLFLLGIVFAPLGAGMFV ASRRVKELRIDYTDCMNIGDEFKQVPSTNIEFQYKNVKNVTAMWKSSGDVCTLRFQIPEE MTSPVFAFYRLKNFYQNHRRYTVSADMFQLLGEARTVAQLKSYGFCKPLEANEEGKPYYP CGIIANSLFNDSYSSLLRYESFDSSNSLGLYNMTTNGTAWPEDRERYKKTKYNASQIVPP PNWAKMFPNGYTDDNIPDVSTWDAFQIWMRAAALPTFSKLALRNVTTALQPGIYEMNITY NFPVTEYKGTKTIMFSTTSVIGGKNYFLGILYFVIGGLCAASGVILSIACLIKPRRVGDP RYLSWNRGKSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ivn1 |
Synonyms | ivn1; pi004; SPACTOKYO_453.33c; SPBC11B10.07c; Invasion protein 1 |
UniProt ID | Q96WW4 |
◆ Recombinant Proteins | ||
KLHL30-611H | Recombinant Human KLHL30 Protein, MYC/DDK-tagged | +Inquiry |
GPR162-3863M | Recombinant Mouse GPR162 Protein, His (Fc)-Avi-tagged | +Inquiry |
SETD8-461H | Recombinant Human SETD8, GST-tagged | +Inquiry |
RFL31915SF | Recombinant Full Length Synechococcus Sp. Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
S100A5-3877H | Recombinant Human S100A5 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
G6PD-6080HCL | Recombinant Human G6PD 293 Cell Lysate | +Inquiry |
CHRM1-7521HCL | Recombinant Human CHRM1 293 Cell Lysate | +Inquiry |
MRPL34-4177HCL | Recombinant Human MRPL34 293 Cell Lysate | +Inquiry |
GOLT1B-301HCL | Recombinant Human GOLT1B lysate | +Inquiry |
SPATA16-1541HCL | Recombinant Human SPATA16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ivn1 Products
Required fields are marked with *
My Review for All ivn1 Products
Required fields are marked with *
0
Inquiry Basket