Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Mitochondrial Carrier C12B10.09(Spac12B10.09) Protein, His-Tagged
Cat.No. : | RFL25359SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C12B10.09(SPAC12B10.09) Protein (Q10442) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MIFNYVFSNSFSFLYLMVNVQCRIKEIMYWNICLYWDVFSKLIIYNKVCQFGRIHIFHGK NRHQLLRTCHFTPSKRHSAMSFFEALGAGICAGLAVDLSLFPIDTLKTRLQAKGGFVKNG GFHGVYRGLGSILVGSAPGASLFFTTYENMKSRLSQSGLGLSDPQIHMCSASLGEIAACI VRVPTEVIKQRAQASGGTLSSRNILQTILKSNNVWRDFYAGYGITIAREIPFTLIQFPIW EHLKLKWRIKHSRNKNLAHEAAISGSIAGGIAAALTTPFDVVKTRIMTSQQRLSYVFTIK SIVAHEGFLALYKGIVPRVLWLSGGGAIFLGCYDVILNFMKAEGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC12B10.09 |
Synonyms | SPAC12B10.09; Uncharacterized mitochondrial carrier C12B10.09 |
UniProt ID | Q10442 |
◆ Recombinant Proteins | ||
MVD-3486R | Recombinant Rat MVD Protein, His (Fc)-Avi-tagged | +Inquiry |
Cysrt1-2427M | Recombinant Mouse Cysrt1 Protein, Myc/DDK-tagged | +Inquiry |
IMPA1-2712H | Recombinant Human IMPA1 protein(11-270 aa), C-His-tagged | +Inquiry |
ZRANB1-19230M | Recombinant Mouse ZRANB1 Protein | +Inquiry |
SHD-5004H | Recombinant Human SHD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF839-204HCL | Recombinant Human ZNF839 cell lysate | +Inquiry |
MAN2A1-4525HCL | Recombinant Human MAN2A1 293 Cell Lysate | +Inquiry |
PTGR1-2708HCL | Recombinant Human PTGR1 293 Cell Lysate | +Inquiry |
CGB5-776HCL | Recombinant Human CGB5 cell lysate | +Inquiry |
IGJ-5259HCL | Recombinant Human IGJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC12B10.09 Products
Required fields are marked with *
My Review for All SPAC12B10.09 Products
Required fields are marked with *
0
Inquiry Basket