Recombinant Full Length Schizosaccharomyces Pombe Udp-Galactose Transporter(Gms1) Protein, His-Tagged
Cat.No. : | RFL9324SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe UDP-galactose transporter(gms1) Protein (P87041) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MAVKGDDVKWKGIPMKYIALVLLTVQNSALILTLNYSRIMPGYDDKRYFTSTAVLLNELI KLVVCFSVGYHQFRKNVGKEAKLRAFLPQIFGGDSWKLAIPAFLYTCQNNLQYVAAGNLT AASFQVTYQLKILTTAIFSILLLHRRLGPMKWFSLFLLTGGIAIVQLQNLNSDDQMSAGP MNPVTGFSAVLVACLISGLAGVYFEKVLKDTNPSLWVRNVQLSFFSLFPCLFTILMKDYH NIAENGFFFGYNSIVWLAILLQAGGGIIVALCVAFADNIMKNFSTSISIIISSLASVYLM DFKISLTFLIGVMLVIAATFLYTKPESKPSPSRGTYIPMTTQDAAAKDVDHKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gms1 |
Synonyms | gms1; SPCC1795.03; UDP-galactose transporter; Golgi UDP-Gal transporter |
UniProt ID | P87041 |
◆ Recombinant Proteins | ||
KCNAB1-2346R | Recombinant Rhesus monkey KCNAB1 Protein, His-tagged | +Inquiry |
RFL29806LF | Recombinant Full Length Lachancea Thermotolerans Altered Inheritance Of Mitochondria Protein 43, Mitochondrial(Aim43) Protein, His-Tagged | +Inquiry |
SMARCAD1-15599M | Recombinant Mouse SMARCAD1 Protein | +Inquiry |
Smarca1-5958M | Recombinant Mouse Smarca1 Protein, Myc/DDK-tagged | +Inquiry |
HK3-2518R | Recombinant Rat HK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM1-1683HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
IYD-885HCL | Recombinant Human IYD cell lysate | +Inquiry |
EIF2D-541HCL | Recombinant Human EIF2D cell lysate | +Inquiry |
SERP1-1942HCL | Recombinant Human SERP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gms1 Products
Required fields are marked with *
My Review for All gms1 Products
Required fields are marked with *
0
Inquiry Basket