Recombinant Full Length Schizosaccharomyces Pombe Translocator Protein Homolog (Spbc725.10) Protein, His-Tagged
Cat.No. : | RFL21448SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Translocator protein homolog (SPBC725.10) Protein (O94327) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | MDLNYQVFTSISKNWWSASLVPVACGWFIGNSYKPRKDYENKKQPKFHPPASAFGPAWTL LYLTMGYASHLAYKADPLMITNASRNGSILYIAQLAANFAWMPLFYGLAKPKLALADLGI LTGLVGWLAKTWWPLAPTASKWLIPYLAWLGYAGYLVSNVTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC725.10 |
Synonyms | SPBC725.10; Translocator protein homolog |
UniProt ID | O94327 |
◆ Recombinant Proteins | ||
DNM1L-3896H | Recombinant Human DNM1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB1BA-11361Z | Recombinant Zebrafish RAB1BA | +Inquiry |
MAPK14-372H | Recombinant Human MAPK14, GST-tagged, Active | +Inquiry |
FGF13-8155H | Recombinant Human FGF13 protein, His-tagged | +Inquiry |
RFL3278SF | Recombinant Full Length Pig Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA4A-2066HCL | Recombinant Human SEMA4A cell lysate | +Inquiry |
TNFRSF19-2454MCL | Recombinant Mouse TNFRSF19 cell lysate | +Inquiry |
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
TUBA1B-661HCL | Recombinant Human TUBA1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPBC725.10 Products
Required fields are marked with *
My Review for All SPBC725.10 Products
Required fields are marked with *
0
Inquiry Basket