Recombinant Full Length Schizosaccharomyces Pombe Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL5181SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Squalene synthase(erg9) Protein (P36596) (1-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-460) |
Form : | Lyophilized powder |
AA Sequence : | MSLANRIEEIRCLCQYKLWNDLPSYGEDENVPQNIRRCYQLLDMTSRSFAVVIKELPNGI REAVMIFYLVLRGLDTVEDDMTLPLDKKLPILRDFYKTIEVEGWTFNESGPNEKDRQLLV EFDVVIKEYLNLSEGYRNVISNITKEMGDGMAYYASLAEKNDGFSVETIEDFNKYCHYVA GLVGIGLSRLFAQSKLEDPDLAHSQAISNSLGLFLQKVNIIRDYREDFDDNRHFWPREIW SKYTSSFGDLCLPDNSEKALECLSDMTANALTHATDALVYLSQLKTQEIFNFCAIPQVMA IATLAAVFRNPDVFQTNVKIRKGQAVQIILHSVNLKNVCDLFLRYTRDIHYKNTPKDPNF LKISIECGKIEQVSESLFPRRFREMYEKAYVSKLSEQKKGNGTQKAILNDEQKELYRKDL QKLGISILFVFFIILVCLAVIFYVFNIRIHWSDFKELNLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | erg9 |
Synonyms | erg9; SPBC646.05c; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | P36596 |
◆ Recombinant Proteins | ||
RFL24101LF | Recombinant Full Length Lactobacillus Johnsonii Glycerol-3-Phosphate Acyltransferase 2(Plsy2) Protein, His-Tagged | +Inquiry |
TNF-716B | Active Recombinant Bovine TNF Protein | +Inquiry |
OLFM2-4167R | Recombinant Rat OLFM2 Protein | +Inquiry |
NR1I3-2913R | Recombinant Rhesus Macaque NR1I3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RET-3948HAF488 | Recombinant Human RET Protein, His/GST-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3A-1999HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
LAMTOR2-2257HCL | Recombinant Human ROBLD3 293 Cell Lysate | +Inquiry |
PTRHD1-112HCL | Recombinant Human PTRHD1 lysate | +Inquiry |
Fetal-93M | Mouse Fetus Tissue Lysate (7 Day Fetus) | +Inquiry |
MCCC2-4428HCL | Recombinant Human MCCC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All erg9 Products
Required fields are marked with *
My Review for All erg9 Products
Required fields are marked with *
0
Inquiry Basket